MUMBAI, India, July 13 -- Intellectual Property India has published a patent application (202647082325 A) filed by Oncopeptides Innovation Ab on July 03, 2026, for Cd16a-Binding Polypeptide.

Inventors include Garcia-Fernandez, Javier; Gelius, Stefan Svensson Pctep Application No; Santangelo, Ellen; and Tjernberg, Agneta.

The application for the patent was published on July 10, 2026, under issue no. 28/2026.

Abstract: The invention provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: [N-terminal portion]-[Helix 1]-[Separating portion]-[Helix 2]-[C- terminal portion], the CD16a-binding motif being the portion [Helix 1]-[Separating portion]-[Helix 2]; wherein the CD16a-binding motif sequence is: QQIAQYEIRRLPNLNHHQTFAFIKSLL (SEQ ID NO: 1). The invention also provides a CD16a-binding polypeptide which comprises at least one motif that binds to CD16a, and wherein said CD16a-binding polypeptide comprises the following structure: [N-terminal portion]-[Helix 1]-[Separating portion]-[Helix 2]-[C-terminal portion], the CD16a-binding motif being the portion [Helix 1]-[Separating portion]-[Helix 2]; wherein the sequence of the CD16a-binding polypeptide is: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2). The invention also provides a CD16a-binding polypeptide which comprises the following structure: [BCMA-binding polypeptide]-[Linker 1]-[BCMA- binding polypeptide]-[Linker 2]-[CD16a-binding polypeptide], wherein: each of the BCMA-binding polypeptides comprises the sequence: VDNKFNKENQFADEEIAALPNLNFYQKWAFIRKLMDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 4); the CD16a-binding polypeptide comprises the sequence: VDNKFNKEQQIAQYEIRRLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 2) or comprises the sequence: VDNKFNKEQQIAQYEIRKLPNLNHHQTFAFIKSLLDDPSQSANLLAEAKKLNDAQAPK (SEQ ID NO: 3); and wherein each of Linker 1 and Linker 2 has the sequence (GGGSG)n, where n is 1, 2 or 3. The invention further provides CD16a binder-drug conjugates and pharmaceutical compositions comprising the CD16a-binding polypeptide and the use of the CD16a- binding polypeptide, CD16a binder-drug conjugate or pharmaceutical composition in medicine, particularly the treatment of cancer such as multiple myeloma.

Disclaimer: Curated by HT Syndication.